Anti-KCNJ1 / ROMK antibody GTX54775 from GeneTex

Description

GeneTex's Anti-KCNJ1 / ROMK antibody is a Rabbit Polyclonal antibody. The Anti-KCNJ1 / ROMK antibody was generated using potassium voltage-gated channel subfamily J member 1, KAB-1, Kcnj, Kcnj1_v1, Kcnj1_v3, ROMK1, ROMK2, ROMK3, kir1.1 as the antigen. The Anti-KCNJ1 / ROMK antibody from GeneTex is a Rabbit Polyclonal antibody to KCNJ1 / ROMK. The Anti-KCNJ1 / ROMK antibody Recognizes Human, Mouse, Rat. The Anti-KCNJ1 / ROMK antibody has been validated for the following Applications: WB, ICC/IF, IHC-Fr, IP

Product Specs
ItemAnti-KCNJ1 / ROMK antibody
CompanyGeneTex
Price Pricing Info Supplier Page
Catalog NumberGTX54775
Quantity50 µl
ApplicationsWB, ICC/IF, IHC-Fr, IP
Concentration0.8mg/ml
Conjugate/TagUnconjugated
FormatPBS, 1% BSA, 0.025% Sodium azide
PurityDepleted of anti-GST antibodies by affinity chromatography on immobilized GST and purified by antigen-affinity chromatography
ReactivityHuman, Mouse, Rat
TargetKCNJ1 / ROMK
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenGST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 ( Intracellular, C-terminus) of rat KCNJ1 (Accession : P35560), (MW: 33 kDa)
NCBI Full Gene Namepotassium voltage-gated channel subfamily J member 1
NCBI Gene AliasesKcnj1_v1, Kcnj1_v3, potassium voltage-gated channel subfamily J member 1, KAB-1, Kcnj, Kcnj1_v1, Kcnj1_v3, ROMK1, ROMK2, ROMK3, kir1.1, KAB-1, Kcnj, ROMK2, ROMK3, kir1.1, ROMK1
ClonalityPolyclonal
Research AreaNeuroscience, Cardiovascular
Gene NameKcnj1